@ CHSETTINGS8/@ /@$/@(/@,/@0/@4/@8/@xV4/@?8.?8 r1) d D //   /@ @-P@`p00=000000 0 0000Vlp@`0t}p@)p@-2\@00  <0 00 P 0PxP#`0p@80@ 0S \0 +1 D     01    / 90@@y0@ 801     $  (  ,  T / 90@000, 01 , / 90@ H01 (  ,  P \ $ ` ( 4 8 /90@X0 0( 4@Xl pRR/80@0 DH/DF-`p$@ P{ U00@000000000  4 3Fa90@D0P(&'  '(&/D0P &'  ' &/D@-  4 4y0@@Gy0@\y0@@Gly0@P/3 8 0s/00@-  @@ P PPP 4P  9904@@000040 0y0@$0  ( ( R/y0@4p@- , @@@|$ @ Tl40,00044 Q  hP @ ```#\` V99;0P@ @h00@0003\Q  @@@L#p@ T99900000p0S2,0| 2  2 R`  ` R2d d R2 Rt2  `2 R ! !R02 0S" 00000000S 00 R101 R10  t10 R@ @0SL <0 81< R R1 R0  0 R 0S 0 0 RH  H0S| 0h0 L L RD0 R 0  Rpy0@&y0@y0@y0@p@-P`XT`@P`\TP`@XT`P`\ QT3 P `@XT`P `\TP `@XT `P`\Q T@PHDP@PLD@PHDP@PLD@ ȠČ@ ĐȌĀp   "N Q:pp,0    0 /$0     / 0 H ПP-`0@@-pB@P`  LL@D@0f@  ,$0fP6O@T:?0@?0@?0@//0 0 "0b0>?0S:0?/8@-P@?00 0#0?8@P/t Rl RP \ L0 R R   ,0 0 /O-p`@0@0@y0@y0@0 //D8@-,0@@@+ P8 <H@8H@-;H4 <0< S0b0000PH@-,0<H  b H@-@d0/y0@0/y0@@-g@6T0@-0 S S S 00  00y0@ПM `0@@-$0Р   `:I `0@2x0@/@-P :|B0@}0@{0@0@-@MPp =:PM PX 6:P&5 P @ 050 02P@0@Dt@0S 0S,T+& :P 9PpX|t 9P d0< Ѝ0B0@B0@|0@|0@|0@Tz0@z0@,z0@B0@{0@||0@B0@{0@{0@B0@B0@/s@-P P e@PPP 0 P `XT`0S P 0 PQ T|'C0@y0@rC0@U3C0@@- 449P( $9PC0@y0@y0@C0@@-1* H 14 RU%H 4 Ryl1l!l h!p H T +X1T  T H!X T004T0 ( P   [9PV *  O9P0/ 00 A9@P 0 0000P 0/| x0t0p  0d0PDD Dx0@C0@y0@B0@y0@ D0@}0@:0@:0@B0@8~0@|90@90@}0@:0@@90@90@90@L:0@D17@-0&468S0S #D+D0@3D0@B0@y0@T}0@4}0@cD0@B0@C0@F-`,M@@`FfR_ RVP=8P0 -R D"<1V  0Sp =7p3;p8W >`PA  '0L R QCS C00l0(P@`@0 50S400 ,ЍD0@~0@0@D0@ D0@0/~0@@-P000 00 Q 0S qЍE0@@-M@ ;Ѝ E0@PD-@P`0U@=S pt`Z 0Sl=PN-pP`㬐" T`$@ZPP @e`MP T`eV  000Ds<P @E0@0@-@(M   P (000 0F5P` P`(Ѝ蠂0@P@-01,03/\P@-01(03/\P@- 1 03/\P/0 |P/0 x R/0 s @-R0 00$03/@l\-@-"M@T /( ;@"ލ@Ѝ/@-0@"M T :@"ލH0@-@T 0S P P 0 8@-PT0 P@ b`7400T:(00T0@88LD E7LDp@-P0```N@N@JD T00Pdp0 cRH  a8p0`d``0 @d@p~0@0@p@-@Pp0DR `QP 0a   010Rp81p@P @P0d @T P P@ @@P @AP\00   P p R *!@B! 0,Q"8Q[ TQ"nUQwTQ"|~`@ P  A Q R:  0 0p~0@0@HF-50S50SP @T@~T*@!51 P0P 6 0 0H$! R$#8 R[ TR$&n UR'w T5R$)| ~ 41 d\ B \ 0 0 0   # P PPQ 00d\ 0 @0@0 PP \PP0 S *1P`C̅ 00 ,Ġ\#à8\[ T\#ƠnU\ǠwT\#ɠ|~cQQ 0LP̃0Q  S: 0 0 B13 SK 0  R`p ! d\0 @@ "00    \ 0   0 0 P`p    A BQ 0SS   01` 0dSf1 p1p0szpp~ppPN P*x1VIx1 U  T1 pp0p3DpPi  00cPp0g~p~ppp( 0e  0ppVPp Z0  0 J 0Z00 0  x0x 0S0h S0D00000dS( 0@@0LD~0@H0@@-p0`PwWP@&P%  0@0V `s`R`V  B$RR0 R0000$R0 00000   4@~0@D-@QTD>T @Z 5pP PGBQ `D0d```F0eS0`Pe00e 0    00PPP000jS 0000yF-pR`PU PU 0S- @40P) @B40 s R @0 S T ,R:S,S: S8 0S 4P %4T" !* @@T0 S :SP0@0 R \,4PPd4P K43T0@F-`AM@ P4U P! P p3P `@P\ d@ʡ 3@P P UpDW00AߍE0@E0@80@80@ 0/$ 0R 00/T0@@- $0S 0/T0@@-P 1PyP YP tP T0Ps8@-$P@  $ $P@8@-@P 0!St@@\0@0/0DD:2P8088 0400  ?F0@mF0@0@T0@V0@F0@F0@ $P8Pp@- 0\ X\H@ `P` DRp\ PPpo0@p@-@%3Pp,`3PP fp pV0@F0@p@-@3P 4`2PP fpppV0@G0@7@-@P000000Ph P P2P P01P P>pG0@D0@wG0@;0@N-R0@2 Q`P@Z  0KS{3/@3/@3/@X4/@4/@@5/@0 l 00( 0d 0 R\ Sa00S^00XSR Y0yS1S tS YS TS 0S nS fS NS FS=0SB 9p 0 5 0\- W  .RR&pW)p0  0W  S 0R XR \  :RRp\0 0+0 &Z :Z! 0 0 @ X@ P@T 1P 8 0 (Ѝ'w0@V0@G0@G0@H0@G0@H0@/ $/T0@p@-PPD0@` 8@1P @T@pTQ0@0 000 /TP@-@P  2@@8@-@P ,0PS 00S P <W 40 0@@ 0S@88Q0@TP@-@P 0 9PQ0@8@-@@PP x1P8P08P 0P/Ps@-@P` P `00 QQ; Q9 <0 0 8< 4 00 8< 4 000 0CSF/@F/@F/@F/@F/@F/@F/@F/@ a 01,10 S0r0L0,Y RQ QQ Q  R RR Y  0pP 0 0 fR 0 SKZ0@Z0@E[0@L[0@S[0@\[0@e[0@M0@H- 0` ?0?0@0M?@?@0& < 8 1R4!f4a<90@[0@[0@@-P@-,@02s0S 2-Ԃ0@8@-P O0"0- X0p  pPT @T*0qu80 "8Ԃ0@[0@p@-O``h-0p<0S0#h@PPZ.?P30l0ph 0P($0 0,P Z03?X0S Q2/\  $:Q$ $$0 0 L0<L04RF _P⌔?PZ0, 000d4,P0@08004000PN03? 03?$ZP00S3Z 

 @ P ᪠嫠#'4"0s 07)t0p SSs{#< )x0S*S8)ipZލL;0@;0@) ;0@@x}4;0@@;0@uy_0@_0@t0@00`0  00D01@01<01$1S?$1(0 0 /0@[/@XZ/@X/@D- M@XP4* 40S 13/ PPDPRN P,002 0S00 000P0S`200Xb_ 70 000uP1)0000P0  ,000 S aP%0SUbPU*_10 R@PD@ 00 ]- p- 00l P) e0g\ 1!00S [! *400PP 0 P }P P p UP W:` Ѝs@-kPP@3P 0`P%  I@Pwtc@XfL Y@ UQ0S|d0@d0@d0@n0@d0@ e0@'w0@D-P`pi@P  (000p00 0~/@$/@(/@@- 0h0 @\ 0 S< 0:0080$0P<0@P0 48<00/P048 < ! /0@-PM@ 0 @ 0T@Ѝ00@-PM@  0  @ 0T@Ѝ0X@-\ @<S<0X@ 0  00S 0 0 0P00 0@-\ @STPPR00B 0 R  00 0X00X000@-<0H H D403/@-`0P #d@p i@T:00Sp0XQd@j P` X@T*@Tm0PpF4 pe0@@-`0P d@p 8@T:00SX1Qd@j`T0 P` %@T :00S 4 pe0@N-`PȐȰ$pZ @ 0,@ S@R@dSI 0T T 0S ` 0 0P0@ @P0 ##U 00 00 e0@e0@e0@e0@4 7@-<@ h& 5\P 0P>0D-p0P<@ 00 Sd`P `V :p 0 P$m  04 e0@D-M`p@P p0 (0`0# 030 RFP @ 0T@ЍN-`0P00 0@P A0 22p000S( l 0T100#a0`102@PB@P  Ѝ00@F-M<@0D0  P0ßp`L  @ @2@P  00  0S(n,̎0 10 0 10LPPP @0rᠢcPP,0 $p `0   040@0 SP0 90P 0b`0 E#RyT0 S0S <0 X\SH0p".d &.0h  l0H0, =x H0p.d .0h  l0H0,=x H |000<0S>">@@  0 P0P0\`0tp @@  0 P 5YP(&PUЍ2Tv"3e0@D-p`@PP{ @P P!P^|1 T040Dp@0 00L000H000P00* 0  Z0000<@ 00,00$00(0y"pM0p`0,0000H`  0@00< ; ;S s04 000M?M @ @ @ @  40,f0@@-@p `PP  .f0@@-00S 3/@-00S 3/@-@-@04 ,?<100sl 0  00 0  0 /N- 0P@2#,p 0 2"4 2#000`J0`FV 0##0l !"(     "8 \ 0 1#(00 0P1!4P1#000v-ah0@N-  0@ P2#,` 0 2"4 2#000 0  2"080 E %@P 0##0# py)(  S py)4y)0 p圗)8 0S f-h0@N- 0P@2#,` 00 0 2"4 2#000p/@P 0##0 0 2#(00 0 !"80 @P 2#0 0 2#(00 0  2#800 0 \ 0 P1!4P1#000 0Z-ah0@h0@p@-@`P9Q" 0!",` !!4!#000f:p5 0 1!41#000p``@@ Pp@fV 0p@T  0p@p1 ` 0/N-\3LĠ PPAL PaLPP [pEPEwuPw匠 Z5P  [.  Z%"Z :ZbP f cP f bP f cP f  - @URwY0@-(Q!A 00T0s0 0 0 Q@0@@\0s00000R00@-(Q!A 00T0s0 0 0 QP@0P\0s0000R01 @-5A{ 00h0@1D-@`` !v`R  - - !-  r  w?  1PpzP  Zw A PpUw?`Ppv`P  Vw k PpUN-`PMp z P@Pt >11n?1 1=11= >C= 0]1101 0S{0 X'5|0B0@ Sq 0=0= 0=0!00S7 3/PP41S( 0 0S 3/0q<`00P`4uP <= 0==03= <|=0= <`=0= <D<0<< 0V0=0 T=0=Tg?#| \0  \%0 00w/@00 0010ĭ= X =PU`"t3 Rꄯ/@ ĭZڡZեFFUPFuPSppW p W㶠p.p.pzW qUPfv``F#!%r  -H -\) 'W㸠p.p.pzWqUPfv``F@Ō |R/   - R R    0480E0D04 $0R0 . R( ,!p//( 0,@-@!#!1|.Q qU;//0P10@//0PS#Q 30@;Q r @   /F-p'@`PH V<0{,`(P$p.<0@0 0S Z00|0 tHV   @01P00MZ111400=-^P P0 S0@S0@'w0@Vj0@H=0@=0@@- 90@#Q004 R- `Rv`-@$ p$ pbQpp$ `wp` $0p$p`y@-@@P00,00@908@-@EP,0(00(0,0 0ss0 E0003/EP8PQ0@- 0P <(0LS (0(0C(@TS(0g \E@F-P90@0z_Pq0S㶠0PxP40zcS  $0` Sv` * c V1$ yD$0 $嶠$ 0R 3S F8@-, @(02! .1PP" "0 0== 0S, 1S , 01S t 0`Pv`=S=0=00S 3/p,=0@h0@///PQ@- (0<@<P! P7 L0 q -  0D-PTBqT(T0{$`( `c@V@`# v00v`@V0$ S0Tm0 =嶠(D0S00 00!0PQ@-@@; (0rQ40$@ .8

V1  ( P 03/00) P5 03/`10V 00$0 0S0  &0S/@/@/@/@0SP 0P00 00 @T @TN%0S NL 0SN-P B{!Ta 0 @T@D@001qz} r R{ |  0s0q00T 00^.$/hSU S  S% S5,0( c Z 1 { QJ0305f,02, S-(0[%:)0 Q% R01ŵ !0, ( bZ!zQ 0 ,0 ,#S 1S0 0 0`0(0S B0 !001 00F0T0Tl0@k0@l0@k0@N-鼰+ {$`VP 0 PUPEP 0U1@0t@[ CCpwpW 70! 000 R :(S@ \0 c00sq Wp\ 0p ,00ЍN "B R@1 t 0@00pmpBM $@ 0HH0@@ 0!/ ЍN-P%Ա`{_ 0S@ @T@D@pTwp0 0@ r R 8 & R  "/R-0S*1nS !S" S  P @  l@pLt̄l  !10!(R B NpEp mu 0s0M  sr ps&wppp (0 js0 S J , \, ^0s000S 0ss0 \x0305q0Ys0 / ]0 000!0Zs0L0l00Z0 sr 00N1 ?0E001Sj0F0  0 k0@l0@@-0S S@@>< @ $  0s00@0S/o0@0D p@-`P\ `@T  4/pp   /S\S`/0S/@-@0pS S SI1`Faa`aa0PPvf  \cP*P0S S S"00``V0! V V0P0p  0"4  00pSp0  0pSp/D-p@ w000P0 ߠ0 `.00 eP`0 0S  S00D:@-`1p@0S@9@`PP  3P@*@ 81 S@`$` 000-0` Sl P@@P P 0 8 P00@ m0@m0@m0@N-MQ@`P1 !)?! ? p? F $!!M??/  0 0 P- !1 @`c!V*Р  p P @`bV ! p ? ? F !!M?P?P P Р РK"m0@00@-@ @ @T 0 S0P@P@PU 0@ S@000\0000Q 000F-QPp1P0 U(` #   @U7 RPE @uPT:JoP0 S?2P>1 <P  0R 0SPEuPU pBPᨐ PE  Up @D |P0@ 0  0S  S00  QGm0@ xH-0P @?0?0@0M?P?P Pl `P 006H PR, P `Kx  =n0@Z0@Z0@x0 0@-TM P @P T H  0@ @00,@L@0 TЍ0 @n0@N-M@(D d ,0TP"d0 SP΍`t* ̰ h h X*hp !' T<*uPP pp`(* U  @{ S`Gx`  0`G@` x`@0|0P`  0/S\S@@ C1Sʝ\\P 0HC> 0  /S\S  ʝɟȟ0ʍP@U `$~d0( S8PH00 0VSe  0 V 0  RZ@X V` ,(0 P0V %0SA  &Sʝ\  0g\ P+ ^ʝ\0V0 S! d/ S H 0NP IP\ 0R $ `$7 @F$\:d0P Sf0Ul `6Pp @Rx 00 'p0Up 0cP S030#SR ʝ\  @k|P 0 00 /S\S ʝ\X SUʝ\00 SM p0d t5` R `%P0PXP%(50`0%4P$Ek000SY   RS@Q `$0 W 0` '0S; l )0SWW  DHRpW P @ + 4zW 0 `4/ /40S 4 0% 4mP hP @ \( $$$D3(#$0 \:`PP(d0 S?2Pl:0,ʝ\00S/H0E @P \$d2 Q`(Q 0CPX\᳠1*,\ (V`! P @ `PPd0 S20P* @( T@jp\`d@% V@1 @!`0 \P @Q`d@g ZVI `hPP@d0 S?2P:* pY0@SP/d0 S2 0P)* pPW`:  0%P@`  0P`@3`gPXd0 S2 0P* p` pލ kn0@'w0@ n0@n0@n0@ Gm0@ n0@@-@`Pp '00 0-Ro0@0 04@- @ #D$@@4$s0R=0@N-`p< @P0 0 0S 0  KY 0( P0` 0 Kcq'  P` `@@ V 0( ЍNЍq0@p0@p0@p0@p0@N-`@PW 303 :: 0 `V p@PZUT# 2\WV:`Vp 0Pd@` p@-@P` 00 00 000pD-@p`PQ P@PUp@-`Q0  p0S@ @PPS:Q Q0@0pp @-@Pd0    `0SPPp0U00 N- M DP H@p y0 0S*0Q `V v  V95P4@\+W) \  L0 k0[ 00`c    RZ/`F@`bZY W0 @X  @  0 RZ/`F@`b 0 0C[ 00SZ[ 0  0SZVXЍq0@N-PMpPs%S0@p0+S  S #S -S 0S @@@@@@0C \` 6&0`F00C P *S``0V`f@ 0.S000@ \ p *0J00A \*P0Z  hP LQ ZQ zQ tQplQplPpL0nS cS %S XSdS iSsS oS pSuS xS0 0`FV0   `FVʐ@ 0 0 MS ISfiS mSa@@(0@: 0^, QQ @@06S(0@: 0[, , Q Q004S@@"($     l00S*[.00[00@@@( 0! v0 @!@` @H0>Pp0T0 F0 ` ?0= @ @%000SP0pGP. LQ 0  lQ  0ZS 0tQ  hQ0Sq q S ?A @P p0S 0bPЍq0@o0@p@-00S 0x\@ D0 R R ``0 P0@DQ p00C 0Cs070CS:Ppo0@@--\`@@-@-  : @ Ѝ/-@-  0꠆0 00( 0$ 0 00 ? /0    / N-0ᤠ(0`p,@ P`  p`T_0 0!Y  U !P 00@Tp@-X XPX`0#D@ <00S0h00  p@  q0@h0@-0SP0#aQ<@  R(E00@`@   q0@RN-M@` >n0?s0Si0?s0 SdpWaPU^0SZ   0 RQ0?s0S SJ (`|,  0@ 0     0 H*00S&  0P0U0P  S0 ``Px11(w0@ x0@T0@p0@,0@.w0@l12.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>v7_dcache_inval_rangeERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x Resetting CPU ... offpc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort MAYBE you should read doc/README.arm-unaligned-accesses not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled A335BONESKU#01SKU#02A335X_SKA335BNLTUnknown board, assuming Beaglebone LT/Black.Could not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM A33515BB1.5Could not get board ID. ddr_vtt_enboard_nameboard_revethaddr not set. Validating first E-fuse MAC Error %d registering CPSW switch ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenv%lxenv_buf [%d bytes] too small for value of "%s" In: No input devices available! Out: No output devices available! Err: No error devices available! .callbacks.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,*** Warning - %s, using default environment Using default environment ERROR: Environment import failed: errno = %d at %s:%d/%s() env_common.c## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' Warning: Non-standard access flags. (0x%x) .flagsethaddr:ma,## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" ERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx CPU-## Loading init Ramdisk from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390shSuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000aisimageDavinci AIS imagefilesystemFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImagescriptScriptstandaloneStandalone ProgramublimageDavinci UBL imagenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedNULL device name! BUG: failure at %s:%d/%s()! miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X 1000BASE-X PHY AN duplexPHY 1000BT statusPHY duplex read failed, assuming half duplex PHY speedPHY AN speed read failed, assuming 10BASE-T serialstdinstdoutstderrCRCCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file, bootcmd=gpio set 53; i2c mw 0x24 1 0x3e; run findfdt; mmc dev 0; if mmc rescan ; then echo micro SD card found;setenv mmcdev 0;else echo No micro SD card found, setting mmcdev to 1;setenv mmcdev 1;fi;setenv bootpart ${mmcdev}:2;mmc dev ${mmcdev}; if mmc rescan; then gpio set 54; echo SD/MMC found on device ${mmcdev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;gpio set 55; if run loaduimage; then gpio set 56; run loadfdt;run mmcboot;fi;fi;bootdelay=1baudrate=115200arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxset_default_envarocsdxbim### ERROR ### Please RESET the board ### U-Boot SPL 2013.04-dirty (Apr 20 2013 - 08:30:43) spl: ymodem err - %s Loaded %d bytes autoloadyesNo Ethernet devices found ethactProblem booting with BOOTP (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** Sandbox hostbootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") usbmmcFATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPart Start Sector Num Sectors UUID Type ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d omap_gpio.ctimed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d spl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: fat register err - %d u-boot.imgspl: error reading image %s, err - %d spl: wrong MMC boot mode Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %04x%04x%c%c%c%c%c%cMMC: no card present Card did not respond to voltage select! %s: %d%c %s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_cdmmc_wpmmc_read_datammc_reset_controller_fsmmmc_send_cmdmmc_init_streammmc_set_iosmmc_write_datammc_init_setupTimeout!nand_base.cnand_do_write_ops: Device is write protected %s: attempt to erase a bad block at page 0x%08x %s: second ID read did not match %02x,%02x against %02x,%02x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! No oob scheme defined for oobsize %d No ECC functions supplied; Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC CONFIG_MTD_ECC_BCH not enabled NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters ECC: uncorrectable. NAND: Unable to find NAND settings in GPMC Configuration - quitting  SPI probe failed. SF: Failed to set up slave SF: Unsupported manufacturer %02x , mapped at %pSF: Detected %s with page size , total W25X40W25X16W25X32W25X64W25Q80BLW25Q16W25Q32W25Q64W25Q128W25Q80W25Q32DWW25Q64DWwait_for_user_access Timeout fullhalflink up on port %d, speed %d, %s duplex link down on port %d cpdma_process timeout error %d submitting rx desc cpswFailed to allocate PHY device for %s:%d Phy not found %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700Cannot find console SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x musb-hdrc~~allocate_instanceUTMI-16UTMI-8OTGmusb_core.c, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: ConfigData=0x%02x (%s) %s: kernel must blacklist external hubs %d.%d%s%s: %sHDRC RTL version %s %s %s: setup fifo_mode %d %s: %d/%d max ep, %d/%d memory USB %s mode controller at %p using %s, IRQ %d PIOmusb_init_controller failed with status %d HostPeripheralep%d%s?%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! WARNING in %s line %d musb_gadget_ep0.cidlesetupin/statusout/statuswaitCould not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d musb_g_ep0_irqmusb_h_ep0_continuemusb_host_rxmusb_h_ep0_irqmusb_ep_programmusb_rx_reiniterror: overflow occurs FAT32 FAT12 FAT16 FAT: Misaligned buffer address (%p) Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s ** Unable to read file %s ** writing %s (((((AAAAAABBBBBB %s %llu Bytes%s%lu.%ld %ciB%s%08lx: %0*x %s himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s:%u: %s: Assertion `%s' failed.EPTGMK0123456789ABCDEF0123456789abcdef## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d bootfile*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathNIS Domain NameBOOTP broadcast %d AM335x U-Boot SPL Retry count exceeded; starting again %pM%s%daddr%saddreth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime, [PRIME] Warning: eth device name has a space! eth Warning: failed to set MAC address ethrotatenounknownnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dipaddrgatewayipnetmaskserveripnvlan*** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) filesizefileaddr/ *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again /s TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx D h/@2Dy0@\y0@$0@/@2Dy0@y0@$0@DDDDP T 0X \ 0000 00000p0t7| 111122|77    $ ( , 0 4 8 < @ H 0L  ` `d 0000 0 0` 5  "  $ ( , 0 "4 "8 "< "@ "H 0L 0000 0 0 $X b\ b0000 0 0 $` 5p 0t   JJ  4}0@/@Ja; 3&PKPKa; Q&PKP2Sa0 Ԫ k&PKP~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@Ȁ0@Ȁ0@Ѐ0@Ѐ0@؀0@؀0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ȁ0@ȁ0@Ё0@Ё0@؁0@؁0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@$3/@D8  !"#$%&'()*+,-./0123456789:<0@<0@g0@(/@/@p/@>g0@T/@L/@p/@g0@T/@L/@p/@$g0@T/@L/@p/@eserial0/@/@D/@`/@/@ /@/@`/@Ȳ/@/@    @  @  @               @